Protein Info for PP_3658 in Pseudomonas putida KT2440

Annotation: putative Aromatic compound MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 176 to 192 (17 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details amino acids 320 to 338 (19 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 382 to 406 (25 residues), see Phobius details amino acids 412 to 431 (20 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 305 (278 residues), 112.3 bits, see alignment E=3.7e-36 amino acids 296 to 433 (138 residues), 52.5 bits, see alignment E=5.7e-18 PF00083: Sugar_tr" amino acids 30 to 296 (267 residues), 94.5 bits, see alignment E=1.1e-30 amino acids 293 to 396 (104 residues), 23.6 bits, see alignment E=3.6e-09 PF06779: MFS_4" amino acids 43 to 186 (144 residues), 37.8 bits, see alignment E=2.2e-13

Best Hits

Swiss-Prot: 39% identical to BENK_ACIAD: Benzoate transport protein (benK) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05548, MFS transporter, AAHS family, benzoate transport protein (inferred from 100% identity to ppu:PP_3658)

Predicted SEED Role

"benzoate MFS transporter BenK" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GR0 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PP_3658 putative Aromatic compound MFS transporter (Pseudomonas putida KT2440)
MSSLNMYTLTEESKFNRFHGLILFWCVLILIIDGYDLAVVGAALPAIMADMQIDATSAGV
MAGSALFGTMLGAIFLGTLADRIGRPKMIAICVALFSVFTAAAGFTDSPLTFSIMRFIAG
LGIGGVLPICTAQMGEFSPLKVRTRLVTIVFAGYSVGGILVALTGKQLIESYGWQYVFYV
AVLPVVLIPFILKSMPDSIGFMLKQGRQDELKVIARRLRPDLVIKDDTQFVGNPQIISAQ
DKPVRSLFLEGRGYSTVMIWMAFMTGLFMVYALNSWLTKLMAMAGFSLGSALNFVIVFNL
GSIFGAILGGWLSDKFSIKHVLVVFYVVGAVALTLLGYTRSTELLFVVVFIVGASTLGTQ
LLAYAYAGDFYPSTIRSTGVGFASGVGRVGAIVAPVLIGALVSMALPLEQNFMAIALAGL
VGAVAVTMINQSRSDSAVVRKKATVAHELT