Protein Info for PP_3635 in Pseudomonas putida KT2440

Annotation: putative Sulfonate ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 68 to 89 (22 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 168 to 184 (17 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 79 to 248 (170 residues), 88.9 bits, see alignment E=1.7e-29

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 99% identity to ppf:Pput_2098)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GT3 at UniProt or InterPro

Protein Sequence (251 amino acids)

>PP_3635 putative Sulfonate ABC transporter, permease protein (Pseudomonas putida KT2440)
MRTHVVHAGLGLVGLLALLLLWWAGVALFGQADGLSARFSPAATLASLVELLGQGEVYGH
IWVSLKRILIGLLLALLMGVPLGLLVGSYRHLEAVTTPAFQFLRMISPLSWMPVVVMLMG
VGDQPIYFLLAFAALWPILLNTAAGVRQLDPRWLQLSRSLSATRWETLCKVIVPGVIGHV
LTGVRLAIGILWIVLVPCEMLGVSAGLGYFILDTRDRLAYSELMAMVLLIGVLGFVLDAL
ARGLHRRWVHG