Protein Info for PP_3633 in Pseudomonas putida KT2440

Annotation: putative ArgC like N-acetyl-gamma-glutamyl-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR01851: N-acetyl-gamma-glutamyl-phosphate reductase" amino acids 4 to 307 (304 residues), 405.2 bits, see alignment E=9.7e-126 PF01118: Semialdhyde_dh" amino acids 45 to 103 (59 residues), 43.2 bits, see alignment E=4.9e-15 PF22698: Semialdhyde_dhC_1" amino acids 117 to 289 (173 residues), 112.7 bits, see alignment E=1.7e-36

Best Hits

Swiss-Prot: 100% identical to ARGC2_PSEPK: N-acetyl-gamma-glutamyl-phosphate reductase 2 (argC2) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 100% identity to ppu:PP_3633)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-, 1.2.1.38

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P59308 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PP_3633 putative ArgC like N-acetyl-gamma-glutamyl-phosphate reductase (Pseudomonas putida KT2440)
MHTPVVFIDGDQGTTGLQIHARLQGRSDLRLLTLPEAERKDPQRRCEAINSADIALLCLP
DDAAREAVAAIHNPQVRVIDASSAHRTTPGWVYGLPELDEQQAERIAQSTRVSNPGCYPT
GAIALLHPLVKAGLLPADYPLNIHAVSGYSGGGRAAVERHEQPGAAKAPALQLYGLELAH
KHVPEIQQHAGLSARPMFMPGYGAYRQGIALSIPLQLRLLPGQVSAEHLQACLEQHYQGA
RHVQVMPLHQCGAAANLDPEALNGSNDLRLALYANPEHGQVLLTAVFDNLGKGASGAAVQ
NLDLMLGALQAHG