Protein Info for PP_3607 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 40 to 66 (27 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 329 to 347 (19 residues), see Phobius details amino acids 358 to 380 (23 residues), see Phobius details PF04143: Sulf_transp" amino acids 55 to 382 (328 residues), 241.2 bits, see alignment E=1e-75

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 100% identity to ppu:PP_3607)

Predicted SEED Role

"FIG00954845: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GW0 at UniProt or InterPro

Protein Sequence (404 amino acids)

>PP_3607 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MGLSATATPEPRRLGAPLIALTLMLASAWFLNLNAGFKQVVLLLVGTALGLTLYHAAFGF
TSAWRVFINERRGAGLRAQMVMLTLAVLLFFPALSAGSLFGNPVTGLVAPAGVSVVFGAF
IFGIGMQLGGGCASGTLFTVGGGNARMLVTLLFFVIGSVSATHHADWWFALPSLPATSIV
QVWGIGPAVLASLAVFGLIAWATVVLEKRRHGALEALPASEHQGLRRFLRGPWPLLWGAI
ALALLNYATLALAGRPWGITSAFALWGAKVLSGLGVDVGSWVFWQAPANAKALAAPLWQD
ITTVMDLGIVLGALLAAGLAGRFAPNLKIPLPSLVAAVIGGLLLGYGSRLAYGCNIGAYF
SGIASGSLHGWLWLVAAYTGNLIGVRLRPLFFVGERRPTMLTGC