Protein Info for PP_3600 in Pseudomonas putida KT2440

Annotation: glucarate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 48 to 71 (24 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 280 to 304 (25 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 374 to 396 (23 residues), see Phobius details amino acids 402 to 424 (23 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 306 (290 residues), 167.4 bits, see alignment E=4.4e-53 TIGR00893: D-galactonate transporter" amino acids 19 to 424 (406 residues), 527.3 bits, see alignment E=1.3e-162

Best Hits

Swiss-Prot: 67% identical to GUDP_BACSU: Probable glucarate transporter (gudP) from Bacillus subtilis (strain 168)

KEGG orthology group: K03535, MFS transporter, ACS family, glucarate transporter (inferred from 100% identity to ppu:PP_3600)

MetaCyc: 69% identical to galactarate/D-glucarate transporter GudP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-203; TRANS-RXN0-204; TRANS-RXN0-523

Predicted SEED Role

"D-galactarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GW7 at UniProt or InterPro

Protein Sequence (454 amino acids)

>PP_3600 glucarate transporter (Pseudomonas putida KT2440)
MQATKKTHVRYLILFMLFLVTTINYADRATIAIAGSSLQKDLGIDAVTLGYIFSAFGWAY
VAGQIPGGWLLDRFGSKNVYAFSIFTWSLFTLLQGFVGGLPVAWAVVTLFTLRFLVGFAE
APSFPGNARIVAAWFPTQERGTASAIFNSAQYFATALFAPIMGWIVFSFGWEHVFVVMGV
LGIIFSMVWLKTIYNPRQHPRISQSELEHIEQNGGLVDMDQKRGSDGPKWGYIKQLLTSR
MLLGVYLGQYCINAITYFFLTWFPVYLVQERGMTILKAGFIASLPAVCGFIGGVLGGVIS
DWLLRRGNSLTFSRKLPIVCGLLLSTTMVFCNYVDAEWMVVGFMTLAFFGKGIGALGWAV
VADTSPKQIAGLSGGLFNTFGNIASITTPIVIGYIISATGSFKWALVYVGANALVAVFSY
LVIVGPIKRIELRDAAPKPHAEPATDGELASSRH