Protein Info for PP_3599 in Pseudomonas putida KT2440

Updated annotation (from data): 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41)
Rationale: Specifically important for utilizing D-Glucuronic Acid. Automated validation from mutant phenotype: the predicted function (4.2.1.41) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: 5-dehydro-4-deoxyglucarate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR03249: 5-dehydro-4-deoxyglucarate dehydratase" amino acids 3 to 300 (298 residues), 442.4 bits, see alignment E=3.6e-137 PF00701: DHDPS" amino acids 12 to 298 (287 residues), 176 bits, see alignment E=3.7e-56

Best Hits

Swiss-Prot: 100% identical to KDGD_PSEPK: 5-dehydro-4-deoxyglucarate dehydratase (PP_3599) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01707, 5-dehydro-4-deoxyglucarate dehydratase [EC: 4.2.1.41] (inferred from 99% identity to ppg:PputGB1_2317)

MetaCyc: 69% identical to 5-dehydro-4-deoxyglucarate dehydratase subunit (Acinetobacter baylyi ADP1)
5-dehydro-4-deoxyglucarate dehydratase. [EC: 4.2.1.41]

Predicted SEED Role

"5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41)" in subsystem D-Galacturonate and D-Glucuronate Utilization or D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GW8 at UniProt or InterPro

Protein Sequence (303 amino acids)

>PP_3599 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (Pseudomonas putida KT2440)
MNPQELKSILSHGLLSFPVTDFNAQGDFNPAGYIKRLEWLAPYGASALFAAGGTGEFFSL
AASEYSQVIKTAVDTCATSVPILAGVGGSTRQAIEYAQEAERLGAKGLLLLPHYLTEASQ
DGVAAHVEAVCKSVNIGVVVYNRNVCRLNADLLEKLAERCPNLIGYKDGLGDIELMVSIR
RRLGERFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFVPKTAMDFYNAIARDDHATVAK
LIDDFFLPYLDIRNRKAGYAVSIVKAGARIAGYDAGPVRTPLTDLTAEEYEMLAALMDKM
GPQ