Protein Info for PP_3598 in Pseudomonas putida KT2440

Updated annotation (from data): gamma-glutamyl-gamma-aminobutyrate hydrolase (EC: 3.5.1.94)
Rationale: Specifically important in nitrogen source Putrescine Dihydrochloride; nitrogen source Propandiamine. 38% identical to E. coli PuuD. This reaction is the next step of putrescine degradation after gamma-glutamyl-putrescine ligase (PP_5184) and oxidase (PP_2448). The phenotype on propandiamine suggests that it is also active on 3-glutamyl-3-aminopropionate. See PMC9004399
Original annotation: Peptidase C26

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 16 to 234 (219 residues), 210.9 bits, E=2.2e-66
• PF00117: GATase
  • amino acids 106 to 238 (133 residues), 51.6 bits, E=9.4e-18

Best Hits

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 99% identity to ppf:Pput_3097)

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (11/13 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (9/11 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• superpathway of ornithine degradation (6/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• putrescine degradation II (3/4 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of phenylpropanoids
• Folate biosynthesis
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85, 3.5.1.94

Use Curated BLAST to search for 2.6.1.85 or 3.5.1.94

Sequence Analysis Tools

See Q88GW9 at UniProt or InterPro

Protein Sequence (269 amino acids)

>PP_3598 gamma-glutamyl-gamma-aminobutyrate hydrolase (EC: 3.5.1.94) (Pseudomonas putida KT2440)
MSNSNIGNKQPSLRKPVVLMTMGSQERKGHDYQVMTHKYITPLVEFSDCVPVLVPTCCGT
EDLETYLDMADGVYLTGAGSNIDPALYGQENQTPGKGQDQNRDLFDIPLVKAAIKRGLPI
FGICRGMQEINVALGGDIYQKVYAEPGFNDHRENPEDPVEVQYAQVHGVKIQPGSWLHDT
LGTDEIRVNSLHGQGLHKLGAGIEAIARAEDGLVEAIHAPSISPFLFAVQWHPEWQAAKN
PDSIKIFQAFGDACRAQVRKAQIKRQHAA