Protein Info for PP_3595 in Pseudomonas putida KT2440

Updated annotation (from data): L-lysine and D-lysine ABC transporter, permease component 2
Rationale: Specifically important for utilization of L-lysine and D-lysine.
Original annotation: Amino acid ABC transporter, membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 28 to 51 (24 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 160 to 190 (31 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 21 to 127 (107 residues), 73.3 bits, see alignment E=9.1e-25 PF00528: BPD_transp_1" amino acids 41 to 231 (191 residues), 80.2 bits, see alignment E=8.5e-27

Best Hits

Swiss-Prot: 37% identical to NOCM_AGRFC: Nopaline transport system permease protein NocM (nocM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to ppu:PP_3595)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GX2 at UniProt or InterPro

Protein Sequence (236 amino acids)

>PP_3595 L-lysine and D-lysine ABC transporter, permease component 2 (Pseudomonas putida KT2440)
MSFDQLLAMVLDPDLLERYGPRFIDGLLVTAKLVAISFSLGAVLGLLLALARLSRSLVLQ
RMAAGYVYFFRGSPLLAQLFLLYYGLGSLKGFWQDVGLWWFFRDAWFCTLLAFTLNTAAY
QAEIFRGSLMAVAPGQHEAARALNLKRSTTFFKVILPQSLLVAIGPLGNELILMIKASAI
ASLVTIYDLMGVTKLAFSRSFDFQIYLWAAVLYLVIVELVRRLLKHLEARLGRHLN