Protein Info for PP_3590 in Pseudomonas putida KT2440

Updated annotation (from data): aromatic-amino-acid transaminase (EC 2.6.1.57)
Rationale: Required for utilization of phenylalanine or tyrosine as the sole nitrogen source (PMID:38323821). Has phenotypes on a variety of carbon sources, which probably indicates a (partly genetically-redundant) biosynthetic role as well. May also act on isoleucine or on 2-aminoadipate, as part of pipecolate degradation (PMC9004399). Was previously proposed to be D-lysine aminotransferase, but is not important for utilizing D-lysine (PMID:38323821). 71% identical to E. coli tyrB.
Original annotation: D-lysine aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 72% identical to TYRB_KLEPN: Tyrosine aminotransferase (tyrB) from Klebsiella pneumoniae

KEGG orthology group: K00832, aromatic-amino-acid transaminase [EC: 2.6.1.57] (inferred from 100% identity to ppu:PP_3590)

MetaCyc: 72% identical to tyrosine aminotransferase monomer (Klebsiella pneumoniae)
R15-RXN [EC: 2.6.1.88]

Predicted SEED Role

"Biosynthetic Aromatic amino acid aminotransferase alpha (EC 2.6.1.57)" in subsystem Phenylalanine and Tyrosine Branches from Chorismate (EC 2.6.1.57)

MetaCyc Pathways

superpathway of aromatic amino acid biosynthesis (18/18 steps found)
superpathway of L-phenylalanine biosynthesis (10/10 steps found)
superpathway of L-tyrosine biosynthesis (10/10 steps found)
L-tyrosine degradation I (5/5 steps found)
ethene biosynthesis III (microbes) (6/7 steps found)
L-phenylalanine biosynthesis I (3/3 steps found)
L-tyrosine biosynthesis I (3/3 steps found)
L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
L-tyrosine biosynthesis III (3/4 steps found)
L-phenylalanine degradation II (anaerobic) (2/3 steps found)
superpathway of chorismate metabolism (42/59 steps found)
L-tyrosine degradation II (1/2 steps found)
atromentin biosynthesis (1/2 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (6/9 steps found)
L-phenylalanine biosynthesis II (2/4 steps found)
L-phenylalanine degradation III (2/4 steps found)
L-tyrosine biosynthesis II (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
4-hydroxybenzoate biosynthesis I (eukaryotes) (2/5 steps found)
superpathway of L-phenylalanine and L-tyrosine biosynthesis (2/5 steps found)
superpathway of plastoquinol biosynthesis (2/5 steps found)
dimethylsulfoniopropanoate biosynthesis III (algae and phytoplankton) (1/4 steps found)
L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
L-homomethionine biosynthesis (2/7 steps found)
(S)-reticuline biosynthesis I (3/11 steps found)
rosmarinic acid biosynthesis I (2/10 steps found)
tropane alkaloids biosynthesis (1/11 steps found)
superpathway of rosmarinic acid biosynthesis (2/14 steps found)
superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (3/16 steps found)
anaerobic aromatic compound degradation (Thauera aromatica) (4/27 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.57

Use Curated BLAST to search for 2.6.1.57 or 2.6.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88GX7 at UniProt or InterPro

Protein Sequence (398 amino acids)

>PP_3590 aromatic-amino-acid transaminase (EC 2.6.1.57) (Pseudomonas putida KT2440)
MFKHVDAYAGDPILSLMETFKADPRADKVNLSIGLYYDEAGVVPQLAAVDAVEKRIAGQD
HEASLYLPMEGLASYRQAIQALLFGADHPAVTGGRVATVQTVGGSGALKVGADFLKRYFP
QSEVWVSNPTWDNHRAIFEGAGFKVHTYPYFDQATRGVDFDGMLATLQSLPANSVVLLHP
CCHNPTGADLQQHQWQQVVEVVKARQLIPFLDIAYQGFAEGLVEDAYAIREMARAGVPCL
VSNSFSKIFSLYGERVGGLSVVCDDEATAQSVLGQLKATVRRNYSSPPNFGAQLVAGVLS
DAGLNAQWAEEVEVMRKRILDMRQALVDALAVLLPGQDFQFFLRQRGMFSYTGFSVEQVR
RLRDEFGVYLIDSGRVCMSGLRPANLQRVAEAFAAVQK