Protein Info for PP_3561 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 238 to 278 (41 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details PF03547: Mem_trans" amino acids 16 to 309 (294 residues), 55.2 bits, see alignment E=4.7e-19 PF01758: SBF" amino acids 230 to 313 (84 residues), 30.8 bits, see alignment E=2.3e-11

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to ppu:PP_3561)

Predicted SEED Role

"FIG00962184: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H04 at UniProt or InterPro

Protein Sequence (315 amino acids)

>PP_3561 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MHVPDHGMLTMLHLLLTTLLPIILLIALGTFLRLRGFLAESFWPGAERLSYYVLLPSLFL
HGLATANLDGIPVLGMAGALMLSTLAGAVLLMLYQGAANHEGADFTSVFQGGIRFNNYIG
ATLAAGIYGSAGIALAAVANAAIVPLVNLLCVLVFARFSARHSSPATVLRAIFANPLIVG
CAGGLVLRATGLGLPAGIDATVKALGQAALPLGLLCVGAALGGASLGQQVRPLMAASAFK
FLVMPLTTWGVCRLFGLSGQAAVVAVLFQALPTASSSYVMARQMGGNAPLMATLIALQTV
AAAATLPLVLMLTLG