Protein Info for PP_3559 in Pseudomonas putida KT2440

Annotation: glycine betaine ABC transporter (permease)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 48 to 67 (20 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 142 to 169 (28 residues), see Phobius details amino acids 207 to 235 (29 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 113 to 270 (158 residues), 100.4 bits, see alignment E=5.3e-33

Best Hits

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 100% identity to ppu:PP_3559)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H06 at UniProt or InterPro

Protein Sequence (282 amino acids)

>PP_3559 glycine betaine ABC transporter (permease) (Pseudomonas putida KT2440)
MSSGFPQTLQFSFADSINRLVDWLVLNYGDHLRSLSDQLLQLLVGLENLLRLLPWWLLLL
LVGLLAWHASRSLLRSAVLVALLALIGMLGLWDKLLQTLALVLVSTGLCVLVGVPLGILL
AARPLARRLLLPVLDVMQTLPAFVYLIPVLMLFGLGKVPAVFATLIYALPPLVRLTELGL
SQIDPSLLQAAHGLGASRWQRLRRIALPLALPSIMAGLNQSVMMALSMVVVASMIGARGL
GEDVLAGIQTLNVGQGMEAGLAIVALAMVIDRISQAYGRSSR