Protein Info for PP_3556 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 signal peptide" amino acids 18 to 18 (1 residues), see Phobius details transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 145 to 170 (26 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 355 to 386 (32 residues), see Phobius details amino acids 417 to 436 (20 residues), see Phobius details PF13726: Na_H_antiport_2" amino acids 2 to 87 (86 residues), 101.4 bits, see alignment E=3.8e-33 PF03553: Na_H_antiporter" amino acids 149 to 433 (285 residues), 285.1 bits, see alignment E=1.1e-88 PF06808: DctM" amino acids 182 to 389 (208 residues), 41.4 bits, see alignment E=1.3e-14

Best Hits

KEGG orthology group: K07084, (no description) (inferred from 100% identity to ppu:PP_3556)

Predicted SEED Role

"Histidine permease YuiF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H09 at UniProt or InterPro

Protein Sequence (439 amino acids)

>PP_3556 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MNAVIAAVGIMLILSLSRVHVVIALIIGALAGGLVGGLGIEGTLKAFNGGLGGGATVALS
YALLGAFAVAIAKSGLAHALADRALGMIDRRGDAKGGKVKWLMIGLMLAVAVSSQNILPI
HIAFIPLLVPPLLYVLTRLRIDRRLIACVITFGLITPYMFLPVGFGNIFLNEILLANVAR
AGVDVSGVNVTHAMAIPAAGMLVGLLVAVFISYRKKRDYDLARIQQVEQVSVQYNPLTLL
VAGLAIAAAFIVQLLLDSMIIGAMVGFLIFSLSGIVKWKETDDLFTEGMKMMAMIGFIMI
TASGFAEVMKATGEVKSLVETSAQWIDHSKGVGALLMLLVGLLVTMGIGSSFSTVPILAA
IFVPLCVQLGFDPLATVCIIGTAGALGDAGSPASDSTLGPTSGLNVDGQHHHIWDTVVPT
FIHYNLPLMAFGWLAAMTL