Protein Info for PP_3552 in Pseudomonas putida KT2440

Annotation: Sensory box histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 TIGR00229: PAS domain S-box protein" amino acids 111 to 233 (123 residues), 69.6 bits, see alignment E=1.4e-23 PF00989: PAS" amino acids 112 to 208 (97 residues), 38.2 bits, see alignment E=3.7e-13 PF08448: PAS_4" amino acids 119 to 226 (108 residues), 34.8 bits, see alignment E=5.2e-12 PF13426: PAS_9" amino acids 129 to 224 (96 residues), 33.8 bits, see alignment E=1e-11 PF08447: PAS_3" amino acids 134 to 219 (86 residues), 43.5 bits, see alignment E=9.4e-15 PF00512: HisKA" amino acids 242 to 310 (69 residues), 30.5 bits, see alignment E=9.2e-11 PF02518: HATPase_c" amino acids 357 to 463 (107 residues), 72.4 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3552)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H13 at UniProt or InterPro

Protein Sequence (468 amino acids)

>PP_3552 Sensory box histidine kinase (Pseudomonas putida KT2440)
MDDTAYPLLAKDPQPSLLLTSDANPLALNPALQAWVAEGPELARWLPANCAALVRACLRQ
HRAISDVEVQVGERIVLWTFMPDNQGQQVLGRCRDASEERHGAREANRARRLYRLIIENT
TDLISRHSPDGRFLDASPAAYRLLGLWPEQLRGMPVHTLLHPRERRQVLRQAAAALDQDG
YHTMTCRVRQATGGYRWFEIASRAIRETYTGAVVEVVSVSRDITLRIEAQESLAHSARLA
TLGELASGIAHEINQPLAAVVNYANASQRYLQGLERDPQARERVGQGLQRISEQATHAAE
VIRRLRAFLRKGPRRLQALDVAELAGEAMRLCAWEAARDQVQVELRMSAQLPLVYADRVL
LEQVLLNLLRNAIDANREQQGERPSRILLCAARDGDGVLVEVADQGPGVAPERLDEIFTP
FTTSKADGLGLGLSMSRSLIEGFGGSLWARAGDNGGLVLCCRLAVSRE