Protein Info for PP_3549 in Pseudomonas putida KT2440

Annotation: multidrug efflux transport system - membrane fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details PF00529: CusB_dom_1" amino acids 34 to 346 (313 residues), 57.1 bits, see alignment E=2.9e-19 PF13533: Biotin_lipoyl_2" amino acids 61 to 109 (49 residues), 40.7 bits, see alignment 3.1e-14 PF16576: HlyD_D23" amino acids 61 to 291 (231 residues), 50.4 bits, see alignment E=3.6e-17 PF13437: HlyD_3" amino acids 217 to 297 (81 residues), 48.4 bits, see alignment E=2.9e-16

Best Hits

Swiss-Prot: 48% identical to EMRA_ECOLI: Multidrug export protein EmrA (emrA) from Escherichia coli (strain K12)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to ppu:PP_3549)

MetaCyc: 48% identical to multidrug efflux pump membrane fusion protein EmrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H16 at UniProt or InterPro

Protein Sequence (397 amino acids)

>PP_3549 multidrug efflux transport system - membrane fusion protein (Pseudomonas putida KT2440)
MATPTDTPTPSVAPEPSRKRKAWLLGLLLLLILAGVGTWAWYSIVGRWHESTDDAYVNGN
VVEITPLVAGTVTSIGADDGDLVHAGQVLLQFDPADSEVALQSAEAKLARSVRQVRGLYS
NVDSLKAQLETRQAELRKAQQDFNRRKVLADSGAIAAEELSHARDDLSVAQAAVNSARQQ
LSTSSALVDDTVVSSHPDVMAAAADLRQAYLDHARTTLVAPVTGYVAKRTVQLGQRLQPG
TATMAVIPLDQVWIDANFKETQLREMRIGQPVEITADVYGSEVKYSGTVDSLGAGTGSAF
ALLPAQNATGNWIKIVQRVPVRIHLSPDQLKDHPLRIGLSTVVEVDLHDQSGPTLAQQPP
QKASYTTQVYDHQLMEADNLIARLIHENSATGKTAQR