Protein Info for PP_3537 in Pseudomonas putida KT2440

Annotation: p-hydroxybenzoate hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02360: 4-hydroxybenzoate 3-monooxygenase
  • amino acids 1 to 391 (391 residues), 671 bits, E=2.5e-206
• PF01494: FAD_binding_3
  • amino acids 2 to 342 (341 residues), 333 bits, E=1.2e-103

Best Hits

Swiss-Prot: 75% identical to PHHY_PSEFL: p-hydroxybenzoate hydroxylase (pobA) from Pseudomonas fluorescens

KEGG orthology group: K00481, p-hydroxybenzoate 3-monooxygenase [EC: 1.14.13.2] (inferred from 100% identity to ppu:PP_3537)

MetaCyc: 93% identical to p-hydroxybenzoate hydroxylase (Pseudomonas putida)
4-hydroxybenzoate 3-monooxygenase. [EC: 1.14.13.2]

Predicted SEED Role

"P-hydroxybenzoate hydroxylase (EC 1.14.13.2)" in subsystem p-Hydroxybenzoate degradation (EC 1.14.13.2)

MetaCyc Pathways

• 4-coumarate degradation (aerobic) (4/5 steps found)
• 4-chlorobenzoate degradation (2/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• bisphenol A degradation (2/5 steps found)
• 4-methylphenol degradation to protocatechuate (1/4 steps found)
• 4-hydroxymandelate degradation (2/6 steps found)
• spongiadioxin C biosynthesis (2/7 steps found)
• polybrominated dihydroxylated diphenyl ethers biosynthesis (2/8 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (19/35 steps found)
• superpathway of aerobic toluene degradation (13/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.2

Sequence Analysis Tools

See Q88H28 at UniProt or InterPro

Protein Sequence (395 amino acids)

>PP_3537 p-hydroxybenzoate hydroxylase (Pseudomonas putida KT2440)
MKTQVAIIGAGPSGLLLGQLLHKAGIDNIIVERQTAEYVLGRIRAGVLEQGTVDLLREAG
VAERMDREGLVHEGVELLVGGRRQRLDLKALTGGKTVMVYGQTEVTRDLMQAREASGAPI
IYSAANVQPHELKGEKPYLTFEKDGRVQRIDCDYIAGCDGFHGISRQSIPEGVLKQYERV
YPFGWLGLLSDTPPVNHELIYAHHERGFALCSQRSQTRSRYYLQVPLQDRVEEWSDERFW
DELKARLPAEVAADLVTGPALEKSIAPLRSLVVEPMQYGHLFLVGDAAHIVPPTGAKGLN
LAASDVNYLYRILVKVYHEGRVDLLAQYSPLALRRVWKGERFSWFMTQLLHDFGSHKDAW
DQKMQEADREYFLTSPAGLVNIAENYVGLPFEEVA