Protein Info for PP_3530 in Pseudomonas putida KT2440

Annotation: putative S-ureidoglycine aminohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR03214: putative allantoin catabolism protein" amino acids 6 to 272 (267 residues), 386.9 bits, see alignment E=2.2e-120 PF05899: Cupin_3" amino acids 63 to 145 (83 residues), 34.3 bits, see alignment E=2.4e-12 PF07883: Cupin_2" amino acids 72 to 140 (69 residues), 34.8 bits, see alignment E=1.7e-12 amino acids 195 to 249 (55 residues), 33.6 bits, see alignment E=3.8e-12

Best Hits

KEGG orthology group: K14977, ureidoglycine aminohydrolase [EC: 3.5.3.-] (inferred from 100% identity to ppf:Pput_2243)

Predicted SEED Role

"Ureidoglycine aminohydrolase"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H35 at UniProt or InterPro

Protein Sequence (278 amino acids)

>PP_3530 putative S-ureidoglycine aminohydrolase (Pseudomonas putida KT2440)
MSNHSYFAPHGGHPAQTELLTDRAMFTEAYAVIPKGVMRDIVTSHLPFWDKMRMWVIARP
LTGFAETFSQYIVELAPEGGSERPELDADAEAVVFIVEGELDITVEGKHHTLVPGGYAFL
APGAEWSLRNNSKSNVTFHWLRKHYQKVEGLDVPESFVTHRDNATVIEMPGTEGRWKTTR
FVDMADMRHDMHVNIVTFQPGGVIPFAETHVMEHGLYVLEGKAVYRLNQDWVEVEAGDFM
WLRAFCPQACYAGGPGNFSYLLYKDVNRHVHLTLNPKR