Protein Info for PP_3511 in Pseudomonas putida KT2440

Annotation: Branched-chain-amino-acid aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 TIGR01123: branched-chain amino acid aminotransferase" amino acids 31 to 338 (308 residues), 447 bits, see alignment E=1.6e-138 PF01063: Aminotran_4" amino acids 57 to 291 (235 residues), 105.9 bits, see alignment E=1.5e-34

Best Hits

Swiss-Prot: 68% identical to ILVE_HAEIN: Branched-chain-amino-acid aminotransferase (ilvE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00826, branched-chain amino acid aminotransferase [EC: 2.6.1.42] (inferred from 98% identity to ppw:PputW619_2410)

Predicted SEED Role

"Branched-chain amino acid aminotransferase (EC 2.6.1.42)" in subsystem Alanine biosynthesis or Branched-Chain Amino Acid Biosynthesis or Isoleucine degradation or Leucine Biosynthesis or Leucine Degradation and HMG-CoA Metabolism or Pyruvate Alanine Serine Interconversions or Valine degradation (EC 2.6.1.42)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H54 at UniProt or InterPro

Protein Sequence (339 amino acids)

>PP_3511 Branched-chain-amino-acid aminotransferase (Pseudomonas putida KT2440)
MSNESINWDKLGFDYIKTDKRYLSVWRNGEWDKGTLTEDNVLHISEGSTALHYGQQCFEG
LKAYRCKDGSINLFRPDQNAARMQRSCARLLMPHVPTDVFIEACKQVVKANEKFVPPHGK
GALYLRPFVIGTGDNIGVRTAPEFIFSVFAIPVGSYFKGGMKPHNFQISSFDRAAPQGTG
AAKVGGNYAASLQPGAEAKKANFADAIYLDPLTHTKIEEVGSANFFGITANNEFVTPKSA
SVLPGITRLSLMELAQSRLGMTVIEGDVEISKLDRFVEAGACGTAAVITPIGGIEYNGKL
HVFHDLEKVGPVTQKLYNELTGIQSGDVEAPAGWIVKVA