Protein Info for PP_3483 in Pseudomonas putida KT2440

Annotation: putative Type II secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 PF00437: T2SSE" amino acids 205 to 594 (390 residues), 407.8 bits, see alignment E=3.5e-126

Best Hits

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 100% identity to ppu:PP_3483)

Predicted SEED Role

"Predicted secretion system X protein GspE-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88H78 at UniProt or InterPro

Protein Sequence (598 amino acids)

>PP_3483 putative Type II secretion system protein (Pseudomonas putida KT2440)
MPEAFDATPESAKPAPTSSRACPLPQDVCSPQTCDVPVGAGMPAKNPAKISAYPRDLLAQ
ARLQATDERLLDCLERLACDTPDTFTRRLGLTLHYPVLDSHSLLASTPRFDKLALAQCLK
RECVLIEQGGQLLGVFADPFDPARLAWIDDVLQGAPLYLAHAADLATFLARHEESFHAVD
ALDHDAEASSEGDPLQRLSLASISEDQSRVVKLVNSTLYDALKLHASDIHLGMTGQGLTI
KYRIDGVLNGAGKASGSAFADQVISRIKVMAELDIGEKRVPQDGRFKVAVGDRQIDFRVS
IMPSIFGEDAVLRVLDKQDLSDRVSGVQLQALGFADETLRALRRLAAEPYGMILVTGPTG
SGKTTTLYAMISEINHGVDKIITIEDPVEYQLPGVLQIPVNEKKGLTFARGLRSILRHDP
DKILVGEIRDPDTAQIAVQSALTGHLVFTTIHANNVFDVIGRFSQMQVDPYSFVSALNAV
LAQRLIRLACPHCATPCEHDDDTLYGSGLTREGVAGWTFVRVKGCGHCRGSGYRGRSAIA
ELLHLDDDLRQMIVERRPLAQIKTLACQRGLRLLRASALDLVRDGRTTLEEINRVTFI