Protein Info for PP_3437 in Pseudomonas putida KT2440

Annotation: putative transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details PF03741: TerC" amino acids 14 to 203 (190 residues), 152.6 bits, see alignment E=1.5e-48 PF00571: CBS" amino acids 372 to 423 (52 residues), 27 bits, see alignment 6.8e-10 PF03471: CorC_HlyC" amino acids 439 to 515 (77 residues), 63.3 bits, see alignment E=2.6e-21

Best Hits

Swiss-Prot: 57% identical to YEGH_ECOLI: UPF0053 protein YegH (yegH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3437)

Predicted SEED Role

"Membrane protein, TerC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HC3 at UniProt or InterPro

Protein Sequence (523 amino acids)

>PP_3437 putative transporter (Pseudomonas putida KT2440)
MEWLADPTAWLGLLTLIVLELVLGIDNLVFIAILADKLPPHQRDRARVIGLSLALIMRLG
LLASISWMVTLTAPLFEVFGKSFSGRDLIMLFGGVFLLFKATMELHERLEGHVTQASGTL
RHAAFWPIVAQIVVLDAVFSLDAVITAVGMVDELSVMMIAVIFSIGIMIVASKPLTRFVN
AHPTVIMLCLGFLMMIGFSLTAEGLGFHIPKGYLYAAIGFSILIELFNQLARARRKRSLQ
QHRPLRERTAHAVLRLLGGRRVEADEVGEEIADLVEGGGEQVLFDRRERVMISGVLNLAE
RPIRTVMTARAEVDVIDLAQPADAIAQALANSPYSRLPLIRDGRVDEPLGFVHKKELLKE
LLSGSQPDLESMARAPLNLLESFSILNALEQMRGQSTHIAFVVNEFGDFTGLLTMTDILE
SIAGELPDASEVEGPGIVQEGEGFVVSGALNLSQVQARTGFSARATEDYQTLAGLVMSLL
DRLPMVGDRLAWNGWMLTVEAVEERRVRQVRLTPNGDADVAGA