Protein Info for PP_3430 in Pseudomonas putida KT2440

Annotation: Sensory box histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 705 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 215 to 317 (103 residues), 39.4 bits, see alignment E=3.1e-14 PF00989: PAS" amino acids 218 to 295 (78 residues), 23.8 bits, see alignment E=1.1e-08 PF08447: PAS_3" amino acids 232 to 299 (68 residues), 45 bits, see alignment E=3.2e-15 PF00512: HisKA" amino acids 337 to 401 (65 residues), 37.1 bits, see alignment E=7.9e-13 PF02518: HATPase_c" amino acids 445 to 564 (120 residues), 64.2 bits, see alignment E=4.2e-21 PF00072: Response_reg" amino acids 589 to 697 (109 residues), 58.4 bits, see alignment E=2.3e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3430)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HD0 at UniProt or InterPro

Protein Sequence (705 amino acids)

>PP_3430 Sensory box histidine kinase/response regulator (Pseudomonas putida KT2440)
MPGLAALWSTLSIAGVTILVANGKPCEPAPQVILQSPVLPSIEPMGERIAQFDWWRTSLG
PLSRWPASLRIAVDMMHLSPFPCAVVWGADLCVVHNNGYRALRALPDALGMAFDTLWSDI
WPAVGPWVFKALEGHSNFVEDPPLRIVRSEGAEPLWCAFGYAPLHDELGNVAGFLHTVIE
TTASVEAHRHWREQVQSFERQVAQHVAEREQFWLLSREAMMMLTPELKLHGANPAWYRIL
GWTQEQVQAMSVMELVHPTERTEVRLAVSGLFQCSHAEQLEIRLRHRDGHYHWFRWSARF
DGSLLTAVGRDITADREEAARQAEALMHNSERMEVVGQLAGGMGHEMNNLLSGIGGSLEL
LQRRLQEGRLERVEAYVDVARDSVQRAMDLTHRLIAFSRHQPLAPRPLDFNRQLRLSEPL
LLRALGAEMRLHWQLDVAPWAVSLDVPQLENALIHLCANAREACLEQGNVTISSVNERLT
AFFPDEGGLPPGDYVALHVEDDGHGMAAADIARAFEPFYTTKPLGRGAGLGLSMVYGFVR
QSGGYAWIESTPEQGTRVSMLFPRSHEPVPDEPAPVPLSQRMARGERLLLVDDELDLRAV
MREYLTERGFDVTDVGDANSALERFRHGGPFDLVITDIGLPGGFSGRQVAKAMRMQLAQQ
KILFITGYADQSIEAQLLDQPGTALLNKPFSLAHLADEALRLLDV