Protein Info for PP_3428 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function containing tetratricopeptide repeat domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13646: HEAT_2" amino acids 57 to 142 (86 residues), 29.7 bits, see alignment E=3.6e-10 PF14559: TPR_19" amino acids 157 to 191 (35 residues), 25 bits, see alignment 1e-08 amino acids 186 to 242 (57 residues), 27.2 bits, see alignment E=2.3e-09 amino acids 262 to 314 (53 residues), 30.4 bits, see alignment 2.1e-10 PF13432: TPR_16" amino acids 157 to 207 (51 residues), 34.2 bits, see alignment 1.5e-11 PF13181: TPR_8" amino acids 175 to 207 (33 residues), 16.1 bits, see alignment 5.6e-06 amino acids 277 to 310 (34 residues), 13.9 bits, see alignment 2.8e-05 PF25064: ARM_TT21_5th" amino acids 176 to 269 (94 residues), 29.2 bits, see alignment E=5.7e-10 PF13431: TPR_17" amino acids 267 to 298 (32 residues), 27.4 bits, see alignment (E = 1.5e-09)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3428)

Predicted SEED Role

"TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HD2 at UniProt or InterPro

Protein Sequence (351 amino acids)

>PP_3428 conserved protein of unknown function containing tetratricopeptide repeat domain (Pseudomonas putida KT2440)
MPRRNRYLIALLLSILVSALFGYLWRDAPPTPPTLPAHSYAKALRQAHDGQPGAARVLYQ
QLQRNDLPAIRRAALYAELPNYPSPQALKLARQDLEHAEPLVRRAAIASIRRLLPPAQRS
LVLGPLLDDSEQSVRFAAVDALLGLDPDAIGLYFGPLQSALEQYQQALEQQPEDADAQVH
LARLYLHENDYTHAAAALQRALAVAPGNLDALATQVRLLERQGHHDASRQVLGKALALSP
DSAFLQYELGLWLKRHEQREYALLALSRAVELDPDNADYRYTLAVTLHELDQLDAAQKQL
ETVLNRQPANRRARVLLIQYWKESGQLQNVQVSLAELERQNPDDPALQQGL