Protein Info for PP_3420 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details PF00512: HisKA" amino acids 273 to 328 (56 residues), 40.1 bits, see alignment 3.1e-14 PF02518: HATPase_c" amino acids 379 to 481 (103 residues), 75.6 bits, see alignment E=4.2e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3420)

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HE0 at UniProt or InterPro

Protein Sequence (497 amino acids)

>PP_3420 Sensor histidine kinase (Pseudomonas putida KT2440)
MQMLEDEVPDKANAPASGRPVPLREFNLLRWFSVISLLIITSVAGGLGYVSTRFVVRDSV
ERDAMLTAQFIQAMAQAEVRHSQLPPGTTMGELLDPRLDLQHLQVTPALAESTRIEFLDH
VEHLPDTLLANVYARDRTIVWSTNVELIGKRIEADGDLERAFRSRKAVSASYHKVADDRE
EQKFQRAPRYLFIENYIPLFDSQGEQVLAMVEIYKEPQDLIRRIQRGYVLIWASTLVGGA
LIYFGLFWIVRRAAHMLHLQQDRLVASETYVALGEMSSAVAHSMRNPLANIRSSAELAQE
TANAAAQKNITDIISQVDRMSRWVRDLLVSLRPASDEPEAVDLVAAIEDTHLAFAQQIER
NGVRFHFEGPDVQWVVSQPLQLTQILNSLFSNALEAMPAGGMLNAQVNVQEGVRAEFVLT
DTGKGMSQQQERMVFKPFFTTKQGGLGVGLALVKRIMERFGGSVSLSSREEEGTRVSLTF
NIAAGGEHGAQHPGRRG