Protein Info for PP_3419 in Pseudomonas putida KT2440

Annotation: Sigma-54 dependent transcriptional regulator/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 PF00072: Response_reg" amino acids 5 to 112 (108 residues), 95.3 bits, see alignment E=6.5e-31 PF14532: Sigma54_activ_2" amino acids 145 to 322 (178 residues), 72.2 bits, see alignment E=1.3e-23 PF00158: Sigma54_activat" amino acids 154 to 317 (164 residues), 217.8 bits, see alignment E=1.9e-68 PF07728: AAA_5" amino acids 174 to 292 (119 residues), 26.6 bits, see alignment E=1.3e-09 PF02954: HTH_8" amino acids 424 to 465 (42 residues), 38.3 bits, see alignment 2.2e-13

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_2343)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HE1 at UniProt or InterPro

Protein Sequence (475 amino acids)

>PP_3419 Sigma-54 dependent transcriptional regulator/response regulator (Pseudomonas putida KT2440)
MEHSILVVEDDEILADNIRTYLSLKGYEVIVCHSAELALEQIKRAQPDAVLTDNSLPGMS
GHDLLRTLVAQAPDLKVIMMTGYGNVEDAVQAMKEGAFHYLTKPVVLAELKLTLDKALAT
ERMERTLSFYQEREAQKSGLQALIGESPVMLTLKHTLRQVLDAERRMASDDLPPVLIEGE
TGTGKELVARALHFDGSRSKGPFIEFNCASIPANLLEAELFGHEKGAFTDAKERRVGLVE
AADGGTLFLDEIGEMDLVLQAKLLKLLEDRSIRRIGAVKERKVDLRVISATNCNLEQMVQ
QGKFRRDLFFRLRIIALKVPRLYSRGQDILLLARHFLAHHSRRYGKPNLRFSAEAESLLL
GYSWPGNVRELRNMLEQTVLLAPNEVVQAHQLNLCMTLVDEPLAQQPMAAMFEMPRHEPE
PGTSLPDMERDLVCKTLDRTDWNVTKSARMLGLSRDMLRYRIEKLGLTRPDKRQW