Protein Info for PP_3386 in Pseudomonas putida KT2440

Annotation: type 6 secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 725 TIGR03361: type VI secretion system Vgr family protein" amino acids 12 to 541 (530 residues), 563.2 bits, see alignment E=5e-173 TIGR01646: Rhs element Vgr protein" amino acids 21 to 523 (503 residues), 423.8 bits, see alignment E=1e-130 PF05954: Phage_GPD" amino acids 29 to 347 (319 residues), 242.5 bits, see alignment E=9.5e-76 PF04717: Phage_base_V" amino acids 406 to 473 (68 residues), 45.8 bits, see alignment E=9.8e-16 PF22178: Gp5_trimer_C" amino acids 490 to 595 (106 residues), 108.3 bits, see alignment E=3.7e-35

Best Hits

KEGG orthology group: K11904, type VI secretion system secreted protein VgrG (inferred from 100% identity to ppu:PP_3386)

Predicted SEED Role

"VgrG-3 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HH2 at UniProt or InterPro

Protein Sequence (725 amino acids)

>PP_3386 type 6 secretion system protein (Pseudomonas putida KT2440)
MPSQSDLRFTFQPLVGRSEFEVVSFELDEAISSPFRLQLELVSFEDDVDFAQLLDKPVLF
TLWQGERPLRYVHGLVSTFSQGETGFDRTRYRALVEPVLARAGLRSNWRIFQQKTVPQIL
EIMLKRQGVNAYELKCLDPHQVREFCVQAGETDLDFMARLAAEEGIVYRFDHTPKQHLLI
ITDRLLALGQISRGAIKTDDEDEGFHNDDVGPDQVLYRSVGGGDQARPCLRRLRYSEQVR
TARQVQRDYTFTHPQYRQEHQAYDNSNTHQSLNYERFDYPGRYKRDAVGVPFTATRLTAL
RHDARIAEVEGDDVRLQPGLSFTLIEHPREDLNVHWRTVSVHHEGTQFTSLQEEAADSQQ
GTRYKQEALLVPGRTEWRPAPLPKPRIDGPHMATVVGPKGEEIYCDQWGRVKVSFPWDRE
SENNEFSSCWVRVSQGWAGGSWGSMAIPRIGQDVIIQYVNADPDQPMITGRTYCGNQLPP
YDLPEHKTRMTIKSQTHKGEGFNELRFEDELGRQEVFIHAERDQNNIVKHDETTRVGNDR
TERVERDETISIGQDRREDIARDESVGIGQNRVHEIGNDDSLSIGRNHRITTGKDRIEQV
GNHRQDITKANHTVEIGGHREQVVAGHSTLQTGEAIRHTTKVYDIQVSESLTIRSPAGLL
RVDGAGITLDGLALAFKGPVSQQATGSNRVTSTSGVPAPGEPICLSCLLKAIADGHTIIR
MEGAS