Protein Info for PP_3382 in Pseudomonas putida KT2440

Annotation: gluconate 2-dehydrogenase cytochrome c subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00034: Cytochrom_C" amino acids 32 to 125 (94 residues), 26.5 bits, see alignment E=2e-09 amino acids 186 to 287 (102 residues), 21.4 bits, see alignment E=7.4e-08 amino acids 314 to 401 (88 residues), 53.2 bits, see alignment E=8.9e-18 PF13442: Cytochrome_CBB3" amino acids 314 to 397 (84 residues), 37.1 bits, see alignment E=5e-13

Best Hits

Swiss-Prot: 65% identical to GADH2_PANCY: Gluconate 2-dehydrogenase cytochrome c subunit from Pantoea cypripedii

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3382)

MetaCyc: 80% identical to D-gluconate dehydrogenase cytochrome c subunit (Pseudomonas fluorescens)
Gluconate 2-dehydrogenase (acceptor). [EC: 1.1.99.3]

Predicted SEED Role

"Gluconate 2-dehydrogenase (EC 1.1.99.3), membrane-bound, cytochrome c" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.3

Use Curated BLAST to search for 1.1.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HH6 at UniProt or InterPro

Protein Sequence (417 amino acids)

>PP_3382 gluconate 2-dehydrogenase cytochrome c subunit (Pseudomonas putida KT2440)
MSMKTLLIATLVLGAGAAAQAVANDDAQVRLGEYLARAGDCVACHTAKGGKPFAGGLPME
TPIGTVYSTNITPAASGIGQYSFEDFDQAVRRGIGKDGSTLYPAMPYPSYARVSEQDMQA
LYAYFMKGVAPVEQANKASDIPWPLSMRWPLAIWRGVFAPEAKPWQASATADPVVNRGAY
LVEGLGHCGACHTPRALTMQEKALSAADGEQFLAGSAPLEGWIAKNLRGDHKDGLGSWSE
AQLVQFLKTGRSDRSAVFGGMSDVVEHSMQHMSDADLTAIARYLKTLPPSNPDDQLHVYD
KQVADALWKGDDSKPGAAVYIDNCAACHRTDGQGYTRVFPALAGNPVVQTADATSLIHVV
LAGGTVPATHSAPSNFTMPAFGWRLSDQEVAEVVNFIRSSWGNQGSAVTAGDVKSLR