Protein Info for PP_3348 in Pseudomonas putida KT2440

Annotation: GGDEF domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 169 to 195 (27 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 211 to 370 (160 residues), 166 bits, see alignment E=3.2e-53 PF00990: GGDEF" amino acids 214 to 366 (153 residues), 155 bits, see alignment E=7.7e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3348)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HK8 at UniProt or InterPro

Protein Sequence (381 amino acids)

>PP_3348 GGDEF domain protein (Pseudomonas putida KT2440)
MTDLDPHDEIAHYVRTDRLEQLFVQSAPAVLGSFLAAVMLCWLGWERFDPQRVMVWMTLL
GVSTGVRTAMFFAYLRAPANQRTAERWEWRYWVTLMLSAAIWGWGAFAVMPADDALGQTL
IMLFAVGMSVSAVSCYSSYRNMTLVSMGLVLLPSTGWLLLQPSTLQQGIALAVLVFAWFV
VSATQSLSSALTTAWRLKHEMQRAHRLAMVASCTDELTGLNNRRAFFDNASAQHVRCRDA
GTFMAVLMLDVDHFKQINDTFGHAAGDQVLQRIGAAISASLRDNDIAGRLGGEEFAILLP
NTPPDTAIEVAERLRALIAKLRVNDEHPVTASIGLAFAKAPATELGALLSSADSAMYLSK
VSGRNRVTVAEPEQEALRKQH