Protein Info for PP_3285 in Pseudomonas putida KT2440

Annotation: detoxifying thioesterase of the phenylacetate degradation pathway

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 TIGR02287: phenylacetic acid degradation protein PaaY" amino acids 3 to 194 (192 residues), 382.5 bits, see alignment E=1.7e-119 PF00132: Hexapep" amino acids 88 to 122 (35 residues), 28.2 bits, see alignment 5.5e-11

Best Hits

Swiss-Prot: 58% identical to CAIE_PROSL: Carnitine operon protein CaiE (caiE) from Proteus sp. (strain LE138)

KEGG orthology group: K08279, carnitine operon protein CaiE (inferred from 100% identity to ppu:PP_3285)

MetaCyc: 60% identical to 2-hydroxycyclohepta-1,4,6-triene-1-carboxyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein PaaY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HR8 at UniProt or InterPro

Protein Sequence (199 amino acids)

>PP_3285 detoxifying thioesterase of the phenylacetate degradation pathway (Pseudomonas putida KT2440)
MPCYRLDGLTPVVHPTAYVHPSAVLIGDVIVGPRCYIGPLASLRGDFGRIVLEEGANLQD
TCVMHGFPGGDTVVERNGHVGHGAVLHGCRVGEDSLIGMNAVVMDGAHVAPRCIVAATAF
VKAGFECAAQSLVMGSPAQVKRPLSEQELAWKQRGTAEYQHLAQRCMNSMVECPPLAEAE
PGRPRMEDTGVRPKGQASA