Protein Info for PP_3284 in Pseudomonas putida KT2440

Annotation: enoyl-CoA hydratase-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00378: ECH_1" amino acids 11 to 256 (246 residues), 246.6 bits, see alignment E=2.6e-77 PF16113: ECH_2" amino acids 15 to 180 (166 residues), 109.8 bits, see alignment E=2.1e-35

Best Hits

Swiss-Prot: 57% identical to PAAF_ECOLI: 2,3-dehydroadipyl-CoA hydratase (paaF) from Escherichia coli (strain K12)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to ppu:PP_3284)

MetaCyc: 79% identical to 2,3-dehydroadipyl-CoA hydratase (Pseudomonas sp. Y2)
Enoyl-CoA hydratase. [EC: 4.2.1.17]

Predicted SEED Role

"Phenylacetate degradation enoyl-CoA hydratase PaaA (EC 4.2.1.17)" (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HR9 at UniProt or InterPro

Protein Sequence (257 amino acids)

>PP_3284 enoyl-CoA hydratase-isomerase (Pseudomonas putida KT2440)
MPRYIDVQAPEHGVQLITLQRPEALNALCTELLAELAAALQAAGNDEHVRATVITGSAKA
FAAGADIREMADRDLVGILNDPRVAHWQSIAAFAKPLIAAVNGYALGGGCELAMCADIVI
ASTDARFGQPEINLGIIPGAGGTQRLLRAVGKPLAMQMVLTGEAITALRAQQAGLVSEIT
QPELTVERAMQVARSIAAKAPLAVRLAKEALLKAGDTDLASGLRFERHAFTLLAGTADRD
EGIRAFQEKRQARFQGR