Protein Info for PP_3280 in Pseudomonas putida KT2440
Annotation: 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 71% identical to PAAJ_ECOLI: 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase (paaJ) from Escherichia coli (strain K12)
KEGG orthology group: K00632, acetyl-CoA acyltransferase [EC: 2.3.1.16] (inferred from 100% identity to ppf:Pput_2479)MetaCyc: 88% identical to beta-ketoadipyl-CoA thiolase (Pseudomonas sp. Y2)
RXN0-6512 [EC: 2.3.1.223]; 3-oxoadipyl-CoA thiolase. [EC: 2.3.1.223, 2.3.1.174]
Predicted SEED Role
"Phenylacetic acid degradation protein PaaE, ketothiolase"
MetaCyc Pathways
- oleate β-oxidation (30/35 steps found)
- superpathway of phenylethylamine degradation (11/11 steps found)
- aromatic compounds degradation via β-ketoadipate (9/9 steps found)
- phenylacetate degradation I (aerobic) (9/9 steps found)
- superpathway of salicylate degradation (7/7 steps found)
- catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
- fatty acid salvage (6/6 steps found)
- 4-hydroxybenzoate biosynthesis III (plants) (5/5 steps found)
- adipate degradation (5/5 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- benzoyl-CoA biosynthesis (3/3 steps found)
- ketolysis (3/3 steps found)
- L-isoleucine degradation I (5/6 steps found)
- 3-oxoadipate degradation (2/2 steps found)
- valproate β-oxidation (7/9 steps found)
- (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (4/5 steps found)
- adipate biosynthesis (4/5 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- pyruvate fermentation to hexanol (engineered) (8/11 steps found)
- 4-methylcatechol degradation (ortho cleavage) (5/7 steps found)
- fatty acid β-oxidation I (generic) (5/7 steps found)
- 2-methyl-branched fatty acid β-oxidation (10/14 steps found)
- polyhydroxybutanoate biosynthesis (2/3 steps found)
- propanoate fermentation to 2-methylbutanoate (4/6 steps found)
- pyruvate fermentation to butanol II (engineered) (4/6 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- acetoacetate degradation (to acetyl CoA) (1/2 steps found)
- fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
- glutaryl-CoA degradation (3/5 steps found)
- ketogenesis (3/5 steps found)
- (2S)-ethylmalonyl-CoA biosynthesis (2/4 steps found)
- toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
- acetyl-CoA fermentation to butanoate (4/7 steps found)
- fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
- 5,6-dehydrokavain biosynthesis (engineered) (6/10 steps found)
- 4-oxopentanoate degradation (5/9 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
- fatty acid β-oxidation VII (yeast peroxisome) (2/5 steps found)
- 2-deoxy-D-ribose degradation II (4/8 steps found)
- (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
- mandelate degradation to acetyl-CoA (11/18 steps found)
- benzoyl-CoA degradation I (aerobic) (3/7 steps found)
- pyruvate fermentation to butanoate (3/7 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
- 4-ethylphenol degradation (anaerobic) (2/6 steps found)
- glycerol degradation to butanol (9/16 steps found)
- ethylbenzene degradation (anaerobic) (1/5 steps found)
- isopropanol biosynthesis (engineered) (1/5 steps found)
- pyruvate fermentation to acetone (1/5 steps found)
- pyruvate fermentation to butanol I (3/8 steps found)
- 3-phenylpropanoate degradation (4/10 steps found)
- 9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (4/10 steps found)
- superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
- 10-trans-heptadecenoyl-CoA degradation (MFE-dependent, yeast) (1/6 steps found)
- benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
- 2-methylpropene degradation (2/8 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
- mevalonate pathway I (eukaryotes and bacteria) (1/7 steps found)
- mevalonate pathway II (haloarchaea) (1/7 steps found)
- L-lysine fermentation to acetate and butanoate (3/10 steps found)
- isoprene biosynthesis II (engineered) (1/8 steps found)
- mevalonate pathway III (Thermoplasma) (1/8 steps found)
- mevalonate pathway IV (archaea) (1/8 steps found)
- methyl tert-butyl ether degradation (2/10 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (4/13 steps found)
- L-glutamate degradation VII (to butanoate) (3/12 steps found)
- ethylmalonyl-CoA pathway (2/11 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (19/35 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (6/17 steps found)
- 10-cis-heptadecenoyl-CoA degradation (yeast) (2/12 steps found)
- 10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (2/12 steps found)
- (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
- crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
- L-tryptophan degradation III (eukaryotic) (3/15 steps found)
- superpathway of L-lysine degradation (23/43 steps found)
- docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
- benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
- superpathway of aerobic toluene degradation (13/30 steps found)
- toluene degradation VI (anaerobic) (4/18 steps found)
- jasmonic acid biosynthesis (4/19 steps found)
- cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
- androstenedione degradation I (aerobic) (7/25 steps found)
- sitosterol degradation to androstenedione (1/18 steps found)
- platensimycin biosynthesis (6/26 steps found)
- superpathway of testosterone and androsterone degradation (7/28 steps found)
- cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (2/22 steps found)
- androstenedione degradation II (anaerobic) (5/27 steps found)
- superpathway of ergosterol biosynthesis I (3/26 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)
- superpathway of cholesterol degradation I (cholesterol oxidase) (9/42 steps found)
- superpathway of cholesterol biosynthesis (3/38 steps found)
- superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
- superpathway of cholesterol degradation III (oxidase) (5/49 steps found)
KEGG Metabolic Maps
- Benzoate degradation via hydroxylation
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Ethylbenzene degradation
- Fatty acid elongation in mitochondria
- Fatty acid metabolism
- Geraniol degradation
- Valine, leucine and isoleucine degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.16, 2.3.1.174
Use Curated BLAST to search for 2.3.1.16 or 2.3.1.174 or 2.3.1.223
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88HS3 at UniProt or InterPro
Protein Sequence (406 amino acids)
>PP_3280 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase (Pseudomonas putida KT2440) MNEPTHADALIIDAVRTPIGRYAGALSSVRADDLAAIPLKALIQRHPELDWKAIDDVIFG CANQAGEDNRNVAHMASLLAGLPLEVPGTTINRLCGSGLDAIGNAARALRCGEAGLMLAG GVESMSRAPFVMGKSEQAFGRAAELFDTTIGWRFVNPLMKAAYGIDSMPETAENVAEQFG ISRADQDAFALRSQHKAAAAQARGRLAREIVPVEIPQRKGPAKVVEHDEHPRGDTTLEQL ARLGTPFREGGSVTAGNASGVNDGACALLLASSAAARRHGLKARGRIVGMAVAGVEPRLM GIGPVPATRKVLALTGLALADLDVIELNEAFAAQGLAVLRELGLADDDPRVNRNGGAIAL GHPLGMSGARLVTTALHELEETAGRYALCTMCIGVGQGIAMIIERL