Protein Info for PP_3254 in Pseudomonas putida KT2440

Annotation: putative Nucleosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF01048: PNP_UDP_1" amino acids 52 to 118 (67 residues), 35.6 bits, see alignment E=3.5e-13 amino acids 158 to 200 (43 residues), 26.1 bits, see alignment 2.7e-10

Best Hits

KEGG orthology group: K01243, S-adenosylhomocysteine/5'-methylthioadenosine nucleosidase [EC: 3.2.2.9] (inferred from 100% identity to ppu:PP_3254)

Predicted SEED Role

"5'-methylthioadenosine nucleosidase (EC 3.2.2.16) / S-adenosylhomocysteine nucleosidase (EC 3.2.2.9)" in subsystem Adenosyl nucleosidases or Methionine Salvage or Polyamine Metabolism or Methionine Biosynthesis or Methionine Degradation (EC 3.2.2.16, EC 3.2.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.16 or 3.2.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HU9 at UniProt or InterPro

Protein Sequence (217 amino acids)

>PP_3254 putative Nucleosidase (Pseudomonas putida KT2440)
MHLARVDRQWPRPLQPLGNTCSMMLIKQFPDISLNDTLFVFALEAEAGDVFTEVNTVFTG
IGKVNAAIALTKAIATRRPKLIVNLGSAGSQRHGKGEVVCCNRFVQRDMDVTALGFARYE
TPLSDTPVVLEHGAAIPGLAVETCGSGDSFEINHGDAPYDVVDMEAYVLALIARGEGIPF
VCLKYISDDAGSEAAGDWAVQVHLAAEAFKRVLFSQA