Protein Info for PP_3253 in Pseudomonas putida KT2440

Annotation: Carboxylate-amine ligase PP_3253

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 148 to 165 (18 residues), see Phobius details TIGR02050: carboxylate-amine ligase, YbdK family" amino acids 6 to 292 (287 residues), 393.3 bits, see alignment E=3.3e-122 PF04107: GCS2" amino acids 7 to 286 (280 residues), 210.1 bits, see alignment E=2.3e-66

Best Hits

Swiss-Prot: 100% identical to GCS2_PSEPK: Putative glutamate--cysteine ligase 2 (PP_3253) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K06048, carboxylate-amine ligase [EC: 6.3.-.-] (inferred from 100% identity to ppu:PP_3253)

Predicted SEED Role

"FIG074102: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HV0 at UniProt or InterPro

Protein Sequence (368 amino acids)

>PP_3253 Carboxylate-amine ligase PP_3253 (Pseudomonas putida KT2440)
MIRPCTFGIEEEYLLVNLGSGQVPATPSPAVMGRCREALGRYFAQEMFRSQIELASPVFT
NLYEAREFLQRNRQRLRVALAEEGMGPYAAASHPCAAWLLQKPAAQGHYKQLFDDYRHVA
RRSLLNGLHVHVGVPPACDRMQLINRLLPWLPLLLALSTSSPLWAGQPTGYLSYRRVICG
EWPHMGLPEALPDWAAYERYRALLQRTGALAADGDLWWALRPSRRYPTVELRICDGCPNL
EDVLCIAALFRHLVEHSIAYRHDPLPCSRELRWIAQENYWRAMRHGRHAQFIGCHEQQPV
TAQGWLAQLQAQIPIDSADAERACQHALHVLRHGTHADQQLRCLAQARADGLGKGQALRA
VVAAGTCI