Protein Info for PP_3250 in Pseudomonas putida KT2440

Annotation: putative Transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 304 to 334 (31 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 334 (308 residues), 53.1 bits, see alignment E=2.6e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3250)

Predicted SEED Role

"putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HV3 at UniProt or InterPro

Protein Sequence (427 amino acids)

>PP_3250 putative Transporter (Pseudomonas putida KT2440)
MQAWRRRLDQGLNIQPGEGPAVIAGLLLFYLLFTGYFMLRPVRETMGVAGGVENLQWLFT
GTFIATLACLPLFGWLASRVQRRHILPWTYGFFASNLLLFAALLAGNPDDLWTARAFYIW
LSVFNLLTISLAWSVLADLFSTAQGKRLFGLLAAGASLGGLSGPVLGTLLVAPLGHAGLL
VLAAVLLLGSIGATLFLQRWRARQPIAMQTEHQGSRPLGGNPFTGASAVLRSPYLLGIAL
FVVLLASVSTFLYFEQARIVSETFTDRTRQTQVFGLIDTVVQALAILTQVFLTGRLARRL
GVGVLLVAVPLIMAAGFLWLALAPVFALFVVVMVVRRAGEYALVRPGREMLFTVLSAEDK
YKAKNFIDTVVYRGGDALSGWVKRALDVMGEHPQLAMLIGALLAVGWGATGAWLGRRQAR
MDSPPHH