Protein Info for PP_3228 in Pseudomonas putida KT2440

Annotation: putative Periplasmic aliphatic sulfonate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 28 to 309 (282 residues), 219.9 bits, see alignment E=2.1e-69 PF13379: NMT1_2" amino acids 54 to 241 (188 residues), 35.3 bits, see alignment E=1.7e-12 PF12974: Phosphonate-bd" amino acids 65 to 180 (116 residues), 42.3 bits, see alignment E=8.9e-15 PF09084: NMT1" amino acids 67 to 183 (117 residues), 42.6 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to ppu:PP_3228)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HX5 at UniProt or InterPro

Protein Sequence (321 amino acids)

>PP_3228 putative Periplasmic aliphatic sulfonate-binding protein (Pseudomonas putida KT2440)
MSIRTKLLTVAVALLLAGHASASERLTLRIGDQKGNMRAQLEAADALRDLPYDIRWAEFP
AAAPLAEALNAGAIDAGIIGDAPLLFVLASGAPVKAIAVDKSDPYGTALLVRPEAPLRSA
AELKGKRIATGRGSIGHHLALKALAQAGLTEKDVEFRFLGPVDAKIALANGSVDAWSTWE
PYTALAELSGQGRVLVNGRGLSTGNSFLAATDKALEEPGRRAALQDYLNRLAAAQVWANQ
HLDTYSKTLAAIIGFPVEAARLQFERRQLRWQVIDTQTVTEQQDTADFYHTHGLMTERLD
VAPTFATGFTLPAAAKLAAQP