Protein Info for PP_3226 in Pseudomonas putida KT2440

Annotation: Acyl-CoA dehydrogenase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02771: Acyl-CoA_dh_N" amino acids 19 to 84 (66 residues), 34.5 bits, see alignment E=4.6e-12 PF02770: Acyl-CoA_dh_M" amino acids 123 to 213 (91 residues), 45.7 bits, see alignment E=1.2e-15 PF00441: Acyl-CoA_dh_1" amino acids 246 to 373 (128 residues), 36.7 bits, see alignment E=9.4e-13 PF08028: Acyl-CoA_dh_2" amino acids 250 to 360 (111 residues), 37.6 bits, see alignment E=5.4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3226)

Predicted SEED Role

"Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.99.2)" in subsystem Isoleucine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HX7 at UniProt or InterPro

Protein Sequence (380 amino acids)

>PP_3226 Acyl-CoA dehydrogenase-related protein (Pseudomonas putida KT2440)
MSLMSQPSDSALAELTLALAANAERYDRSAQFPQDNFHLLHRHGLLALTVPRAFGGGGAD
LASARRVIGAVGKGDPATALILVMQYLQHFRLQDEARWPEPLRQRVAYDAVRHGALINAL
RVEPELGTPARGGLPATVARRTAEGWRLSGRKIYSTGSHGLTWYLVWGRSDDNDPLVGGF
LVHCDTPGITIIDDWDHLGMRATCSHEVRFDDVLIPLDHAVSVSPASAPQAELDGESLLW
MAVLLPAVYDGVARAARDWLAGFLKQRTPSNLGAPLASLPRFQHVLGRIDTLLFANQSLL
DGAAAGHISPQHAGQLKHLVSANAIQAVELAIEAAGNPGLSRRNPLERHYRDVLCSRIHT
PQDDVVFGQVGRAALTEVQA