Protein Info for PP_3221 in Pseudomonas putida KT2440

Annotation: ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 44 to 65 (22 residues), see Phobius details amino acids 107 to 133 (27 residues), see Phobius details amino acids 144 to 184 (41 residues), see Phobius details amino acids 225 to 250 (26 residues), see Phobius details amino acids 269 to 293 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 123 to 293 (171 residues), 104.6 bits, see alignment E=2.8e-34

Best Hits

Swiss-Prot: 40% identical to DPPC_BACPE: Dipeptide transport system permease protein DppC (dppC) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to ppu:PP_3221)

MetaCyc: 35% identical to nickel ABC transporter membrane subunit NikC (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88HY2 at UniProt or InterPro

Protein Sequence (302 amino acids)

>PP_3221 ABC transporter, permease protein (Pseudomonas putida KT2440)
MTLDIPLSPLDTAPSEPRPAATWRRRTRWQRAYQMLAPLLRRPGFSLALLIVLFALLCAL
APHWLSSFDPYATAPADKLSPPSLAHWFGTDELGRDLYTRVVYGARLSVLAALLAVAIAL
LGGLGLGVLAGFAGGHVDAALMRLIDVLLALPGLLLALAIVTAIGFGTVPVAVAVGVGIL
PGFARTTRAEVLRIKTLPFVEAARLCGASWARTLLRHVLPNAWSPVAVLATLDFGAAILA
TAGLSFLGFGAAPPAAEWGTLIANGRHFLITAPWLSLLPGLFVVAVVFSLNHLARSAEEH
AR