Protein Info for PP_3202 in Pseudomonas putida KT2440

Annotation: putative Transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 826 transmembrane" amino acids 31 to 48 (18 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 337 to 360 (24 residues), see Phobius details amino acids 367 to 394 (28 residues), see Phobius details amino acids 430 to 449 (20 residues), see Phobius details amino acids 633 to 649 (17 residues), see Phobius details amino acids 656 to 679 (24 residues), see Phobius details amino acids 685 to 708 (24 residues), see Phobius details amino acids 720 to 747 (28 residues), see Phobius details amino acids 759 to 783 (25 residues), see Phobius details PF03176: MMPL" amino acids 199 to 428 (230 residues), 31.6 bits, see alignment E=4.3e-12 amino acids 589 to 781 (193 residues), 49.5 bits, see alignment E=1.6e-17

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 100% identity to ppu:PP_3202)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I00 at UniProt or InterPro

Protein Sequence (826 amino acids)

>PP_3202 putative Transporter (Pseudomonas putida KT2440)
MNSSAPSTGPLDDFDSASGSLLERALFNHRVLVLLLCLAATLLLGWQASRLTLNASFEKM
IPRDHPFIHNYLEHRQELAGLGNAVRIAVANPRGSIYDKDYLHSLQQLNDAVYLLPGVDR
AAMKSLWTPSTRWTGVTEEGLEGGPVVPDGYDGAAASLEALKRNVERSNEIGQLVAFDQR
SSIVYVPLLEKTPDGQALDYTAFAHELETLRERFQAQGVEIHITGFAKVVGDLMDGLRQI
LLFFAAAIAITAAVLYWYTRCVRSTALVVVCSLVAVIWQLGLLPLLGYALDPYSVLVPFL
VFAIGMSHGAQKMNGIMQDIGRGMHRLVAARFTFRRLFLAGLTALLCDAVGFAVLMIIQI
QVIQDLAVIASLGVAVLIFTNLILLPVLLSYVGVSARAARRSLRAEEAEASGAGKHAVWR
FLDLFTRRRWAAACIAVAALMAAGGYAVSLHLKVGDLDAGAPELRADSRYNRDNAFVTRH
YGASSDVFAVMVRTAPGGCSAYGTLKHVDDLDWQLRGLQGVDSTNSLALLNRRVLVGLSE
GSPKWYDLVNNQATLNMVTAGAPRGLYNDDCSLLTLYAYLTDHKADTLARVVDSVQAFAQ
ANDSEQASFLMAAGSAGIEAATNQVVKQANRDMLWWVYGAVIVLCLVTFRSWRAVLCAVL
PLVLTSILCEALMVALGIGVKVATLPVIALGVGIGVDYALYVMSIVLAQLRQGASLSQAY
YRALLFTGKVVMLTGITLAIGVGTWIFSPIKFQADMGVLLAFMFVWNMVGALILLPALAY
FLLPHRKACTEQLALPAHEHTRRERSSGMLEQGASFRPLEEVSHGR