Protein Info for PP_3190 in Pseudomonas putida KT2440

Annotation: Ornithine cyclodeaminase/mu-crystallin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 40% identical to Y0419_RHIME: Putative dehydrogenase RB0419 (eutC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01750, ornithine cyclodeaminase [EC: 4.3.1.12] (inferred from 100% identity to ppu:PP_3190)

Predicted SEED Role

"Ornithine cyclodeaminase (EC 4.3.1.12)" in subsystem Arginine and Ornithine Degradation (EC 4.3.1.12)

MetaCyc Pathways

L-ornithine degradation I (L-proline biosynthesis) (1/1 steps found)
L-arginine degradation VII (arginase 3 pathway) (1/2 steps found)
L-proline biosynthesis II (from arginine) (1/2 steps found)

KEGG Metabolic Maps

Arginine and proline metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.12

Use Curated BLAST to search for 4.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I12 at UniProt or InterPro

Protein Sequence (315 amino acids)

>PP_3190 Ornithine cyclodeaminase/mu-crystallin family protein (Pseudomonas putida KT2440)
MRVFSKAQIVAHFNPELAVSQLEEGFIAYSEGKVQVPPVQGFAFKGANGDCCVKSAYIEG
SPTFTVKLSTGFYDNPSKGLPSNDGLMLVLSAHTGQPLALLQDQGWLTAMRTALAGRIAA
RLLAPSQVKAIGILGTGMQAQMQLEQLRAVTDCRQVIVWGRHERGLAAYTAFARELGFAV
HSTQDAAEVAGAANLIVCTTPSRQALLHSDWVQPGTHITAVGADAPGKQELDPALVARAD
RIIVDAIAQCSQYGEVAHALGCGRIDANQLIELGTLLAGRAKGREHDSQITLADLTGVAV
QDAQVASHALAALCT