Protein Info for PP_3187 in Pseudomonas putida KT2440

Annotation: Cytosine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 99 to 124 (26 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 226 to 253 (28 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details amino acids 366 to 384 (19 residues), see Phobius details amino acids 390 to 408 (19 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 23 to 396 (374 residues), 59.5 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: K10974, cytosine permease (inferred from 100% identity to ppu:PP_3187)

Predicted SEED Role

"Cytosine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I15 at UniProt or InterPro

Protein Sequence (421 amino acids)

>PP_3187 Cytosine transporter (Pseudomonas putida KT2440)
MSSPSEFPLSEAPQSARKGLLPIAMVLFSFTFFTGTMFAGGKLGMAFSFVDMLWVATLGN
SLLALYAAALAFIASRSGLNTVLMGRFCFGEAGSRLSDFLLGFAELGWYAWGTATVAIVL
VKLLGLADGFGMPLMVLFGLGFSITAIIGFKGLDLLSRVSVPLMFVLLLVSMYIATRDAG
GFAGLAAVVPHETMTFSAAVTMVFGTFASGATQATNWTRLARSGRVAVIASGVAFLLGNG
LMVVAGAWCAMVYQQADIVDVMMLQGLSFAAVVMLCLNLWTIQGPTIYNVSAAACHLLRS
ERRRTATLVAAGVGIVLAMGGMYEMLIPFLVLLGSIIPPVGGVIMADFWYRHRGKYPPLC
TANLPRYNLTGLFAYAVGAVLAYASPWVAPLVGIAASAVCYIVILELGARRRAPGQAGVE
P