Protein Info for PP_3186 in Pseudomonas putida KT2440

Annotation: putative Transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03070: TENA_THI-4
  • amino acids 10 to 216 (207 residues), 174.6 bits, E=1.2e-55
• TIGR04306: thiaminase II
  • amino acids 12 to 215 (204 residues), 133.6 bits, E=3.8e-43

Best Hits

KEGG orthology group: K03707, thiaminase (transcriptional activator TenA) [EC: 3.5.99.2] (inferred from 100% identity to ppu:PP_3186)

Predicted SEED Role

"Thiaminase II (EC 3.5.99.2)" in subsystem Thiamin biosynthesis (EC 3.5.99.2)

MetaCyc Pathways

• base-degraded thiamine salvage (1/2 steps found)
• thiamine diphosphate salvage IV (yeast) (4/7 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.99.2

Use Curated BLAST to search for 3.5.99.2

Sequence Analysis Tools

See Q88I16 at UniProt or InterPro

Protein Sequence (219 amino acids)

>PP_3186 putative Transcriptional activator (Pseudomonas putida KT2440)
MDIFERLKAAATPQWNRYVDHDFVRQMGAGTLSEEAFRTYLVQDYLFLIQFARAWALAAY
KSRRPADIRAAQAGLSAILDETELHLRLCARWGLTQADIEAAPEHQATVAYTRYVLDCGA
AGDLLELHVALAPCVIGYAEIGRTLAERIGDLSNHPYREWIGEYAGEGYQGVAAAARKHL
DELAARSMTEQRFAELAGIFGQASSLEADFWQMGLDGTV