Protein Info for PP_3168 in Pseudomonas putida KT2440

Annotation: porin-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03573: OprD" amino acids 24 to 414 (391 residues), 520.3 bits, see alignment E=1.9e-160

Best Hits

Swiss-Prot: 60% identical to NICP_PSEPK: Porin-like protein NicP (nicP) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_2547)

Predicted SEED Role

"benzoate-specific porin" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I33 at UniProt or InterPro

Protein Sequence (416 amino acids)

>PP_3168 porin-like protein (Pseudomonas putida KT2440)
MNHTPCVALGLTLLSQPLLAAEGGFFEDSKATLSARNYYFSRDFSDIVGANKQSKAEEWA
QGFILDFKSGYTPGPVGFGVDALGLLGIKLDSSPDRTNTGLLPVHGDGRAADEYSRLAPT
FKARLSKTELRAGELQPNLPVLTFSDIRLLPPTYQGVSLSSSEIDGLTMQAGHLKSTHLR
NEGGDGKMNAMLGHVPMRQAESDAFNYVGGDYAFNANQSSVSLWYGQLEDIYQQGFVGLK
HSKPVGDWVLSANLGYFTAREQGDALLGNIDNQAFFSLFTARHGGHSFHAGYQGIYGDSP
FPRVFANISPLGNEVPTYEFAYTDERSYQVRYDYNFAAMGVPGLTATVRYITGNNVDTGL
GYEGRDRERDLDIGYAVQSGALKGLGIRVRNAMARSNYRSDIDENRLTLVYTWQLF