Protein Info for PP_3159 in Pseudomonas putida KT2440

Annotation: BenABC operon transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 PF14525: AraC_binding_2" amino acids 23 to 173 (151 residues), 71.5 bits, see alignment E=1.5e-23 PF02311: AraC_binding" amino acids 54 to 178 (125 residues), 48.4 bits, see alignment E=1.6e-16 PF12833: HTH_18" amino acids 234 to 316 (83 residues), 69.7 bits, see alignment E=4.3e-23

Best Hits

Swiss-Prot: 61% identical to XYLS3_PSEPU: XylDLEGF operon transcriptional activator 3 (xylS3) from Pseudomonas putida

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3159)

Predicted SEED Role

"benABC operon transcriptional activator BenR" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I42 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PP_3159 BenABC operon transcriptional activator (Pseudomonas putida KT2440)
MESRLLSERSSVFHHADPYAVSDYVNQHVGQHCIGLSRTTHPQASLSHRKFAELDLCRIS
YGGSVRVTSPALETIYHLQVLLNGNCLWRGHKREQHLVPGELLLINPDDPVDLTYSEDCE
KFILKVPTRLLDSICDEQRWQRPDGGVRFLRNHYRLDELDGFVNLLAMVCHEAEVSDSLP
RVQGHYSQIVASKLLTLMSTNIRRESLSAPQAGLERILDYIERNLKLELSAEVLAEQACM
SLRSLYALFDQHLGITPKHYVRQRKLERVHACLSDPTCGVRSVTELALDYGFLHLGRFSE
IYRQQFGELPSQTFKRRA