Protein Info for PP_3140 in Pseudomonas putida KT2440

Annotation: Glycosyl transferase, group 2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 300 to 325 (26 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 356 to 381 (26 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 45 to 266 (222 residues), 64.8 bits, see alignment E=1.9e-21 PF00535: Glycos_transf_2" amino acids 49 to 143 (95 residues), 38.2 bits, see alignment E=2.1e-13 PF13632: Glyco_trans_2_3" amino acids 129 to 344 (216 residues), 42.6 bits, see alignment E=9.2e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3140)

Predicted SEED Role

"Dolichol-phosphate mannosyltransferase (EC 2.4.1.83) in lipid-linked oligosaccharide synthesis cluster" (EC 2.4.1.83)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I61 at UniProt or InterPro

Protein Sequence (395 amino acids)

>PP_3140 Glycosyl transferase, group 2 family protein (Pseudomonas putida KT2440)
MISVLGWLLGLLAIIVLVPVSVLLLQVLLACLPARSRPKGIGERPRVAVLVPAHDEALVI
RAMLASVTPQLLDGDRLLVVADNCSDDTARLARASGAEVVERHDTRLRGKGYALDFGVRH
LAQRPPEVVIVVDADCQVGEGAIDCLARRCHALARPVQSLYLMRAPAGAGLRVQVAEFAW
RVKNLVRPRGWARLGLPCQLMGAGMAFGWHDLSLINLANGHLVEDVKLGLDLCQQGKPPA
FCPEALVTSQFPLSQQGLNSQRTRWEHGHLGLMLADAPKRAMAAITQRNASLAALTLDLL
VPPLALLVLTLLGLNLVTWLAYLLFGLAAPAWLAFAGLALLAFAVVLAWARFCREVIPFS
VLLYAPFYAARKIPLYLSFLIKRQVEWVRSKRDDD