Protein Info for PP_3139 in Pseudomonas putida KT2440

Annotation: Glycosyl transferase, group 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 PF20706: GT4-conflict" amino acids 172 to 339 (168 residues), 29.5 bits, see alignment E=7.8e-11 PF13692: Glyco_trans_1_4" amino acids 222 to 362 (141 residues), 123.4 bits, see alignment E=1.8e-39 PF00534: Glycos_transf_1" amino acids 222 to 378 (157 residues), 122 bits, see alignment E=3.9e-39 PF13524: Glyco_trans_1_2" amino acids 274 to 393 (120 residues), 31.4 bits, see alignment E=3.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3139)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I62 at UniProt or InterPro

Protein Sequence (400 amino acids)

>PP_3139 Glycosyl transferase, group 1 family protein (Pseudomonas putida KT2440)
MRIAYFINQYPKVSHSFIRREILALERQGVEVQRIALRGWDAEVQDAEDASERGKTRYVL
QGGLKGLLAPTWQVLRTQPRRFFQALWLAMRLGLRADRAWPYHLVYLAEACQVLQWLQAG
EATHVHAHFGTNSTEVVMLANALGGPAYSFTVHGPEEFDKPQFLHLGEKVRRAAFVAAVS
SYGRSQLYRWVAPEQWGKVKVVHCGLERGFHEVAPVNVPPAPRLVCVGRLCEQKGQLLLL
EAARCLAAQSIAFELVLAGDGEMREQIEALIARHGLQQQVRITGWISSAQVREEILAARA
LVLPSFAEGLPVVIMEAMALRRPVLTTYVAGIPELVRPGENGWLFPAGAVDELATAMADC
LAQPAEVLQRMGEVAYQRAVQRHDIDTEAARLADYFKAYA