Protein Info for PP_3132 in Pseudomonas putida KT2440

Annotation: putative Polysaccharide transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 48 to 67 (20 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 266 to 292 (27 residues), see Phobius details amino acids 313 to 337 (25 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 382 to 398 (17 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details amino acids 435 to 456 (22 residues), see Phobius details PF01943: Polysacc_synt" amino acids 18 to 294 (277 residues), 63.4 bits, see alignment E=2.4e-21 PF13440: Polysacc_synt_3" amino acids 40 to 345 (306 residues), 148.7 bits, see alignment E=2.2e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3132)

Predicted SEED Role

"polysaccharide transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I69 at UniProt or InterPro

Protein Sequence (458 amino acids)

>PP_3132 putative Polysaccharide transporter (Pseudomonas putida KT2440)
MPSIDVSAAASLRKRALRAGSWNLVSQVASQVMRLGGNLIMARLLLPEMFGVMVIATTVS
ILLHLLSDVGLRQNIIQSHRGDDPDFLNTAWTVQIIRGFLLFALTLLLALGAWLAQLAEL
WPADSTYAAPVLPMVLAVTGLSAAIWGFQSTKIDVAVRTFQQKRVVLVDLASQVAGLVVM
LVLGLLTHSIWALVLSGLVSAVVWTVLGHTALEGPNNHLRWDRSALTELIVFGRWILLSS
MVGVLAMYGDRIWFGASMSAAQLGVYSIAVLILGAVQTALMKIVGAVALPAFSEAARADD
KPRLKALYFRFRLLVDLLVLFICGGFLTASPLLIGWMYDDRYREAGPMLAILSLSFIVLR
YTLAHQVWIALGLTKYQAMDNIIRLVSLWGLLPLLLAIGGVEWAIWGVALHAAPTLVLVV
YVNCKLDIFSLKRELVVLPMLLVGALCGALLTAFFNWL