Protein Info for PP_3131 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 68 (27 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 108 to 124 (17 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 166 to 182 (17 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 284 to 312 (29 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 407 to 429 (23 residues), see Phobius details amino acids 450 to 479 (30 residues), see Phobius details PF04932: Wzy_C" amino acids 281 to 420 (140 residues), 42.8 bits, see alignment E=2.5e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3131)

Predicted SEED Role

"FIG00956128: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I70 at UniProt or InterPro

Protein Sequence (508 amino acids)

>PP_3131 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MPEHFRALIVILFLASVVFLMARRPATDLIPLSDYKRRRNLWFLLTLLAFFSHSFWLYLG
VGAVVLLLAGRREHNPMALFYMLLFLIPPASVQVPGFGVVNYLVDLNHIRLLTLCVLLPA
ALYLRRQGDTLRFGRIWADKLLAAGLLLMSVLYLRETTLTDTLRQALYLYVDVLLPYYVA
SRGLRQISDFKDTLLAFVLASFVMALIAVAEYVRHWLLYSALVDAMGVPWSMSGYLSRGG
ALRASVTTGQAIALGYVMSVAIGLFLFVQGYVQRPLHKAMGALLLAAGLFAPLSRGPWIG
AVVIVVVFIALGKGAVKRLALLGAAGMLALPLLTVVPGGEKVLDLLPFIGNLEKENITYR
ERLMDNSWIVIQRNPLFGSFDFRNTPEMQAMIQGDGIIDIVNTYINLALRVGLVGLGLFV
AFFAVVLRGIRKAMLSFADKDDERRQLGRVLLATLIGILVIIFTVSSITFIPVVYWSIAG
LGVAYIQMVRRLHNSPAVELAEPDLQPR