Protein Info for PP_3106 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 TIGR03361: type VI secretion system Vgr family protein" amino acids 21 to 535 (515 residues), 653.6 bits, see alignment E=2e-200 TIGR01646: Rhs element Vgr protein" amino acids 32 to 517 (486 residues), 455.9 bits, see alignment E=1.9e-140 PF05954: Phage_GPD" amino acids 38 to 346 (309 residues), 343.5 bits, see alignment E=2.2e-106 PF04717: Phage_base_V" amino acids 398 to 465 (68 residues), 53.5 bits, see alignment E=5.1e-18 PF22178: Gp5_trimer_C" amino acids 482 to 571 (90 residues), 81.1 bits, see alignment E=1.3e-26 PF06715: Gp5_C" amino acids 525 to 546 (22 residues), 24.9 bits, see alignment (E = 3e-09)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3106)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88I93 at UniProt or InterPro

Protein Sequence (618 amino acids)

>PP_3106 conserved protein of unknown function (Pseudomonas putida KT2440)
MLTDVLSMLAPQNRRLFKLNILTQTANDEFLLEHFSGTEELSKLYEFDLALLSQQSDVKL
KSLIGSQATVEIELSNGSFRHINGYVQRFSTQGSDGGYVRYAAVLGPWLWMLTCRFDTRI
FQEKSVQAVVSEVFAGFGTLAKYEFRVSKPLKSHSYITQYRESDFNFVQRLLESEGLFYY
FEHTADSHLMVITDDSSTLLPLPEQPQIRYHSASVTETADSITQWQSTRQLQSGQIAVRT
FDYRQPRNFLPVTMQSLNQQGDVDRFEIYDFPGQYTHGSYEDGEAIVRNRIEALELMGKT
FYGESNCRAMKPGYTFELTQHYLHDTGAAENRKFLLLSVEHRGSNNYMTGDQAGYVNRFV
CVRKKIAYRPQLNTRKPLINGPQTAIVVGPPGEEIFTDELGRVKLQFHWDRQGQFNDQSS
CWVRVAQSGASGGFGSIQIPRVGDEVVVVFLDGNPDRPLIMGSLYNSTNTPPWSLPANKT
QSGFLTRSMKGDGGTANFFRFEDKAGAEQIIMHAERNMDTEIELDETHDVGNNRSITVGG
THTETVKKDTVVQVTEGSYTLQVDNQFIQVAAKQHIILQVGDSSITLTPEGIEIKGKVIV
TTSTDTTQITGAAVRIND