Protein Info for PP_3095 in Pseudomonas putida KT2440

Annotation: Protein ClpV1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 878 PF02861: Clp_N" amino acids 22 to 135 (114 residues), 52.9 bits, see alignment E=2.4e-17 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 23 to 866 (844 residues), 1318.8 bits, see alignment E=0 PF00004: AAA" amino acids 238 to 351 (114 residues), 35.5 bits, see alignment E=7.4e-12 amino acids 615 to 733 (119 residues), 30.2 bits, see alignment E=3.2e-10 PF17871: AAA_lid_9" amino acids 378 to 479 (102 residues), 102.6 bits, see alignment E=5.9e-33 PF07724: AAA_2" amino acids 609 to 776 (168 residues), 193.6 bits, see alignment E=1.4e-60 PF07728: AAA_5" amino acids 614 to 735 (122 residues), 39.8 bits, see alignment E=2.5e-13 PF10431: ClpB_D2-small" amino acids 784 to 856 (73 residues), 48.7 bits, see alignment E=3.6e-16

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 100% identity to ppu:PP_3095)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IA4 at UniProt or InterPro

Protein Sequence (878 amino acids)

>PP_3095 Protein ClpV1 (Pseudomonas putida KT2440)
MRRLPHSLRWGRLVNLKSLFAKLNETSRTATESAAALCLSEHHYEVEVEHLLLQLLDNND
SDLAPILRHYQVVAERLQAQLVTALGTFKKGNTRTPALSPHITRMIEQAWLLASIEYGVG
QVRSAHLLQALLDDAELRRVVIASAPELEKINADDLRLNLAALVEGSAESRQASPLASPA
APVSTSSKASGKTPALDQYTVNLTQSAREGRIDPVLGREFEVRQMVDILTRRRQNNPILT
GEAGVGKTAVVEGLALRIAQGDVPAVLKDVALHTLDLGLLQAGAGVKGEFENRLKAVIEE
VKRSLHPIILFIDEAHTLIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEK
DAALARRFQVVKVEEPDEDKAIHMLRGLLGKMREHHKVAVMDEALVQAVRLSNRYITGRQ
LPDKAVSVLDTACARIALAQSSLPGALEDCRRQIDNLQAEIDVLGHEAGKGHDHARRLES
LQAALQAEQQQEQQLNAQWQQELELVEQLKALDAANDADAQQLNTLRAELARVQGDQPLV
HALVDSGAIAQVISGWTGIPLGKMLRDEIDTVQRLPALLGERVLGQDHALHEIGKRIKIS
RARMEDPNKPIGVFLLLGPSGVGKTETALALADTLYGGERNLITINMSEYQEAHTVSSLK
GSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGVLDDGEGREI
NFRNTVIILTSNTGTERIMQTCLNATELPTPEAIVEDLRDQLNHVFKPAFLGRLSIVPFY
PVQDQILERIVALKLERIAKRFARNHQAELSYDQALVKAIAARCTEVDSGARNIDNILSQ
TLMPELAQRVLERMAQDAPIQHLAIELGSDGDFAYRLA