Protein Info for PP_3090 in Pseudomonas putida KT2440

Annotation: OmpA domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 831 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 444 to 464 (21 residues), see Phobius details TIGR03348: type VI secretion protein IcmF" amino acids 18 to 559 (542 residues), 429.6 bits, see alignment E=1.5e-132 PF14331: IcmF-related_N" amino acids 189 to 446 (258 residues), 255 bits, see alignment E=1.2e-79 PF06761: IcmF-related" amino acids 498 to 694 (197 residues), 50 bits, see alignment E=4.4e-17 PF00691: OmpA" amino acids 716 to 805 (90 residues), 52.3 bits, see alignment E=9.5e-18

Best Hits

KEGG orthology group: K11891, type VI secretion system protein ImpL (inferred from 100% identity to ppu:PP_3090)

Predicted SEED Role

"OmpA domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IA9 at UniProt or InterPro

Protein Sequence (831 amino acids)

>PP_3090 OmpA domain protein (Pseudomonas putida KT2440)
MNKLKYYCLRYQPYLLGVAFFLAIFLVWAIGRAFGFASLHSLLAGIGVFLLLSAGYVLLL
YRGVGQHHNLEGLLRDDADQAVLSAAPADREEVSLLRERLLQGIERLHSNKPRGTSNKDA
LYALPWYLVIGQPAAGKSTMILQSGLNFPYAEREGVRVAGLGGTRNCDWFFSSEAVLLDT
AGRYMNSPEEAGKWRGFLQLLRQHRQRRPLNGLIVSVSIADILHGSVEDQERVAKRLRER
IQESCALLEVRLPIYLVFTKCDLIPGFTAFYRQLDDAARGEVMGKTFSHKGYEQADWGQR
FSNAMDELTRYWGQMASQQLVQQDIQVTRRNDAAYRFPLELAALKPRLHQFVDSLLRANP
YQNAEMLRGFYFTAALQADEAQWGCHGQHVAERFALEHAEGTGTAGSQPAPLFINSLFRK
VIIPDQHLVALYTSNHRERRRKAGWVGAAGLAALVLCSLWGWSYLNNRATLASIADELAQ
AKADDQAASGQYTAWRSLDRLRFWAAHYHEQHHAKGVPLGMRLGLYQGHEVEPLLRDRYF
ATLQNVMLKPTADNLTRTLYLLTTLKVYQRNTRELQPVSGIDSVEAEALPHDNRAQSIAN
FGKAALDTYVMLSPGQREHADPAFLKAHLPDYWYPAIARQTGKSMAAAGSEAGGNQDYLY
ASRQITFYSDQIREPDVPRILDNAFLMSSSRNYIDSLRAQSLRAIETITLESDTLFAFGR
ADFQSLKNEGQHQLSAIASKLLNTPNIGKIIISGHADQLGDSQGNLQVSKQRAQTIRTYL
VGKGVPAELVVAQGEGSRKPLVNCDMQQPRTQLIKCLEPNRRVEIEVRGLN