Protein Info for PP_3083 in Pseudomonas putida KT2440

Annotation: putative Membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 60 to 83 (24 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details PF03547: Mem_trans" amino acids 146 to 286 (141 residues), 44.8 bits, see alignment E=3.3e-16

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to ppu:PP_3083)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IB6 at UniProt or InterPro

Protein Sequence (291 amino acids)

>PP_3083 putative Membrane protein (Pseudomonas putida KT2440)
MFASLFAVLAPVFIVAGIGFAWARKGLDYPTDFIARVVMTVGTPSLVLSTLSRTELDPNA
FTSVAVACLLCTLGMALAALLVCRASGMHWRVLLPAFMFPNTGNMGLPISLYAFGEHGLA
LAVAFFLTLSIVQFTIGMAISGTAASLKALLRNPIVISLAGAMPIIFLDFELPRWLANTA
DLLGGMTIPLMLLTLGVSLASIRLRHVGSGMLLGGLRIGLGAAVGWAVGAVLGMDSLERA
VLMVQSAMPVAVFNYLMAVRANREPEQVANLVMCSTVLSFAWLPVLLAWWM