Protein Info for PP_3077 in Pseudomonas putida KT2440

Annotation: putative ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 122 to 142 (21 residues), see Phobius details amino acids 154 to 181 (28 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 268 to 295 (28 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 138 to 345 (208 residues), 125.8 bits, see alignment E=1.7e-40

Best Hits

Swiss-Prot: 62% identical to YEJB_ECO57: Inner membrane ABC transporter permease protein YejB (yejB) from Escherichia coli O157:H7

KEGG orthology group: K13894, microcin C transport system permease protein (inferred from 99% identity to ppf:Pput_2647)

MetaCyc: 62% identical to putative oligopeptide ABC transporter membrane subunit YejB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88IC2 at UniProt or InterPro

Protein Sequence (352 amino acids)

>PP_3077 putative ABC transporter permease protein (Pseudomonas putida KT2440)
MTAYILRRLLLIIPTLLAILLVNFAIVQAAPGGPVEQAVARLQGLGGGAPGARAEVVHGE
SRATRGLDPKLIEEIKRQYGFDKSAPERLWLMLGQYARLDFGNSFFRGAKVTDLILDKLP
VTLSLGFWATLITYLVSIPLGIRKAMRHGSRFDAWSSALIVIGYALPSFLFALLLIVLFA
GGTSLNWFPVRGLVSDNFDELSLLGKVADYFWHLVLPVAALVIGGFATLTLLTKNAFLDE
VSRQYVVTARAKGLSERRVLYGHVLRNAMLLVVAGLPQALITVFFAGSLLIEVIFSLDGL
GRMSYEAAVSRDYPVVFGTLFIFTLAGLLIRLIGDLSYTLLDPRIDFDTRAH